LOCUS PX1CG 5386 bp ss-DNA circular PHG 16-JUN-2004 DEFINITION Coliphage phi-X174, complete genome. ACCESSION J02482 M10348 M10379 M10714 M10749 M10750 M10866 M10867 M24859 V01128 VERSION J02482.1 GI:216019 KEYWORDS . SOURCE Enterobacteria phage phiX174 ORGANISM Enterobacteria phage phiX174 Viruses; ssDNA viruses; Microviridae; Microvirus. REFERENCE 1 (bases 1047 to 1094) AUTHORS Ziff,E.B., Sedat,J.W. and Galibert,F. TITLE Determination of the nucleotide sequence of a fragment of bacteriophage phiX 174 DNA JOURNAL Nature New Biol. 241 (106), 34-37 (1973) PUBMED 4349156 REFERENCE 2 (bases 2370 to 2421) AUTHORS Robertson,H.D., Barrell,B.G., Weith,H.L. and Donelson,J.E. TITLE Isolation and sequence analysis of a ribosome-protected fragment from bacteriophage phiX 174 DNA JOURNAL Nature New Biol. 241 (106), 38-40 (1973) PUBMED 4572838 REFERENCE 3 (bases 2370 to 2420) AUTHORS Barrell,B.G., Weith,H.L., Donelson,J.E. and Robertson,H.D. TITLE Sequence analysis of the ribosome-protected bacteriophase phiX174 DNA fragment containing the gene G initiation site JOURNAL J. Mol. Biol. 92 (3), 377-393 (1975) PUBMED 1095758 REFERENCE 4 (bases 2365 to 2591) AUTHORS Air,G.M., Blackburn,E.H., Sanger,F. and Coulson,A.R. TITLE The nucleotide and amino acid sequences of the N (5') terminal region of gene G of bacteriophage phiphiX 174 JOURNAL J. Mol. Biol. 96 (4), 703-719 (1975) PUBMED 1081600 REFERENCE 5 (bases 2263 to 2421) AUTHORS Fiddes,J.C. TITLE Nucleotide sequence of the intercistronic region between genes G and F in bacteriophage phiX174 DNA JOURNAL J. Mol. Biol. 107 (1), 1-24 (1976) PUBMED 826639 REFERENCE 6 (bases 1017 to 1081) AUTHORS Sedat,J., Ziff,E. and Galibert,F. TITLE Direct determination of DNA nucleotide sequences. Structure of large specific fragments of bacteriophage phiX174 DNA JOURNAL J. Mol. Biol. 107 (4), 391-416 (1976) PUBMED 1003475 REFERENCE 7 (bases 730 to 903) AUTHORS Blackburn,E.H. TITLE Transcription and sequence analysis of a fragment of bacteriophage phiX174 DNA JOURNAL J. Mol. Biol. 107 (4), 417-431 (1976) PUBMED 826641 REFERENCE 8 (bases 1017 to 1762) AUTHORS Air,G.M., Blackburn,E.H., Coulson,A.R., Galibert,F., Sanger,F., Sedat,J.W. and Ziff,E.B. TITLE Gene F of bacteriophage phiX174. Correlation of nucleotide sequences from the DNA and amino acid sequences from the gene product JOURNAL J. Mol. Biol. 107 (4), 445-458 (1976) PUBMED 1088826 REFERENCE 9 (bases 2395 to 2922) AUTHORS Air,G.M., Sanger,F. and Coulson,A.R. TITLE Nucleotide and amino acid sequences of gene G of omegaX174 JOURNAL J. Mol. Biol. 108 (3), 519-533 (1976) PUBMED 1088827 REFERENCE 10 (bases 4137 to 4207) AUTHORS Mansfeld,A.D., Vereijken,J.M. and Jansz,H.S. TITLE The nucleotide sequence of a DNA fragment, 71 base pairs in length, near the origin of DNA replication of bacteriophage 0X174 JOURNAL Nucleic Acids Res. 3 (10), 2827-2844 (1976) PUBMED 995652 REFERENCE 11 (bases 4505 to 5374) AUTHORS Brown,N.L. and Smith,M. TITLE The sequence of a region of bacteriophage phiX174 DNA coding for parts of genes A and B JOURNAL J. Mol. Biol. 116 (1), 1-28 (1977) PUBMED 592379 REFERENCE 12 (bases 1 to 5375) AUTHORS Sanger,F., Air,G.M., Barrell,B.G., Brown,N.L., Coulson,A.R., Fiddes,C.A., Hutchison,C.A., Slocombe,P.M. and Smith,M. TITLE Nucleotide sequence of bacteriophage phi X174 DNA JOURNAL Nature 265 (5596), 687-695 (1977) PUBMED 870828 REFERENCE 13 (bases 5022 to 5132) AUTHORS Brown,N.L. and Smith,M. TITLE DNA sequence of a region of the phi X174 genome coding for a ribosome binding site JOURNAL Nature 265 (5596), 695-698 (1977) PUBMED 859573 REFERENCE 14 (bases 5346 to 5386; 1 to 159) AUTHORS Smith,M., Brown,N.L., Air,G.M., Barrell,B.G., Coulson,A.R., Hutchison,C.A. III and Sanger,F. TITLE DNA sequence at the C termini of the overlapping genes A and B in bacteriophage phi X174 JOURNAL Nature 265 (5596), 702-705 (1977) PUBMED 859575 REFERENCE 15 (sites) AUTHORS Fiddes,J.C. TITLE The nucleotide sequence of a viral DNA JOURNAL Sci. Am. 237 (6), 54-67 (1977) PUBMED 929160 REFERENCE 16 (bases 1 to 5386) AUTHORS Sanger,F., Coulson,A.R., Friedmann,T., Air,G.M., Barrell,B.G., Brown,N.L., Fiddes,J.C., Hutchison,C.A. III, Slocombe,P.M. and Smith,M. TITLE The nucleotide sequence of bacteriophage phiX174 JOURNAL J. Mol. Biol. 125 (2), 225-246 (1978) PUBMED 731693 REFERENCE 17 (bases 1290 to 1302; 1340 to 1430; 1510 to 1570; 1600 to 1750) AUTHORS Air,G.M., Coulson,A.R., Fiddes,J.C., Friedmann,T., Hutchison,C.A. III, Sanger,F., Slocombe,P.M. and Smith,A.J. TITLE Nucleotide sequence of the F protein coding region of bacteriophage phiX174 and the amino acid sequence of its product JOURNAL J. Mol. Biol. 125 (2), 247-254 (1978) PUBMED 731694 REFERENCE 18 (bases 4256 to 4317) AUTHORS Langeveld,S.A., van Mansfeld,A.D., de Winter,J.M. and Weisbeek,P.J. TITLE Cleavage of single-stranded DNA by the A and A* proteins of bacteriophage phi X174 JOURNAL Nucleic Acids Res. 7 (8), 2177-2188 (1979) PUBMED 160544 REFERENCE 19 (bases 4248 to 4332) AUTHORS Heidekamp,F., Langeveld,S.A., Baas,P.D. and Jansz,H.S. TITLE Studies of the recognition sequence of phi X174 gene A protein. Cleavage site of phi X gene A protein in St-1 RFI DNA JOURNAL Nucleic Acids Res. 8 (9), 2009-2021 (1980) PUBMED 6253953 REFERENCE 20 (bases 436 to 490; 630 to 669; 930 to 979) AUTHORS Takeshita,M., Kappen,L.S., Grollman,A.P., Eisenberg,M. and Goldberg,I.H. TITLE Strand scission of deoxyribonucleic acid by neocarzinostatin, auromomycin, and bleomycin: studies on base release and nucleotide sequence specificity JOURNAL Biochemistry 20 (26), 7599-7606 (1981) PUBMED 6173064 REFERENCE 22 (bases 1064 to 1757) AUTHORS Merville,M.P., Piette,J., Lopez,M., Decuyper,J. and van de Vorst,A. TITLE Termination sites of the in vitro DNA synthesis on single-stranded DNA photosensitized by promazines JOURNAL J. Biol. Chem. 259 (24), 15069-15077 (1984) PUBMED 6239864 REFERENCE 23 (bases 2380 to 2512; 2593 to 2786; 2788 to 2947) AUTHORS Air,G.M., Els,M.C., Brown,L.E., Laver,W.G. and Webster,R.G. TITLE Location of antigenic sites on the three-dimensional structure of the influenza N2 virus neuraminidase JOURNAL Virology 145 (2), 237-248 (1985) PUBMED 2411049 REFERENCE 24 (bases 449 to 482; 504 to 598; 1047 to 1111) AUTHORS Ueda,K., Morita,J. and Komano,T. TITLE Sequence specificity of heat-labile sites in DNA induced by mitomycin C JOURNAL Biochemistry 23 (8), 1634-1640 (1984) PUBMED 6232949 COMMENT On Apr 28, 2004 this sequence version replaced gi:15535. [8] intermittent sequences. [15] review; discussion of complete genome. Double checked with sumex tape. Single-stranded circular DNA which codes for eleven proteins. Replicative form is duplex, icosahedron, related to s13 & g4. [21] indicates that mitomycin C reduced with sodium borohydride induced heat-labile sites in DNA most preferentially at dinucleotide sequence 'gt' (especially 'Pu-g-t'). Bacteriophage phi-X174 single stranded DNA molecules were irradiated with near UV light in the presence of promazine derivatives, after priming with restriction fragments or synthetic primers [22]. The resulting DNA fragments were used as templates for in vitro complementary chain synthesis by E.coli DNA polymerase I [22]. More than 90% of the observed chain terminations were mapped one nucleotide before a guanine residue [22]. Photoreaction occurred more predominantly with guanine residues localized in single-stranded parts of the genome [22]. These same guanine residues could also be damaged when the reaction was performed in the dark, in the presence of promazine cation radicals [22]. FEATURES Location/Qualifiers source 1..5386 /organism="Enterobacteria phage phiX174" /mol_type="genomic DNA" /db_xref="taxon:10847" CDS join(3981..5386,1..136) /function="viral strand synthesis" /note="rf replication" /codon_start=1 /transl_table=11 /product="A" /protein_id="AAA32570.1" /db_xref="GI:216020" /translation="MVRSYYPSECHADYFDFERIEALKPAIEACGISTLSQSPMLGFH KQMDNRIKLLEEILSFRMQGVEFDNGDMYVDGHKAASDVRDEFVSVTEKLMDELAQCY NVLPQLDINNTIDHRPEGDEKWFLENEKTVTQFCRKLAAERPLKDIRDEYNYPKKKGI KDECSRLLEASTMKSRRGFAIQRLMNAMRQAHADGWFIVFDTLTLADDRLEAFYDNPN ALRDYFRDIGRMVLAAEGRKANDSHADCYQYFCVPEYGTANGRLHFHAVHFMRTLPTG SVDPNFGRRVRNRRQLNSLQNTWPYGYSMPIAVRYTQDAFSRSGWLWPVDAKGEPLKA TSYMAVGFYVAKYVNKKSDMDLAAKGLGAKEWNNSLKTKLSLLPKKLFRIRMSRNFGM KMLTMTNLSTECLIQLTKLGYDATPFNQILKQNAKREMRLRLGKVTVADVLAAQPVTT NLLKFMRASIKMIGVSNLQSFIASMTQKLTLSDISDESKNYLDKAGITTACLRIKSKW TAGGK" CDS join(4497..5386,1..136) /function="shut off host DNA synthesis" /codon_start=1 /transl_table=11 /product="A*" /protein_id="AAA32571.1" /db_xref="GI:216021" /translation="MKSRRGFAIQRLMNAMRQAHADGWFIVFDTLTLADDRLEAFYDN PNALRDYFRDIGRMVLAAEGRKANDSHADCYQYFCVPEYGTANGRLHFHAVHFMRTLP TGSVDPNFGRRVRNRRQLNSLQNTWPYGYSMPIAVRYTQDAFSRSGWLWPVDAKGEPL KATSYMAVGFYVAKYVNKKSDMDLAAKGLGAKEWNNSLKTKLSLLPKKLFRIRMSRNF GMKMLTMTNLSTECLIQLTKLGYDATPFNQILKQNAKREMRLRLGKVTVADVLAAQPV TTNLLKFMRASIKMIGVSNLQSFIASMTQKLTLSDISDESKNYLDKAGITTACLRIKS KWTAGGK" CDS join(5075..5386,1..51) /function="capsid morphogenesis" /codon_start=1 /transl_table=11 /product="B" /protein_id="AAA32572.1" /db_xref="GI:216022" /translation="MEQLTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTY QAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQ PAEFYRFHDAEVNTFGYF" variation 23 /note="in am18 and am35 [14]" /replace="t" variation 25 /note="ts116 [14]" /replace="c" CDS 51..221 /codon_start=1 /transl_table=11 /product="K" /protein_id="AAA32573.1" /db_xref="GI:216023" /translation="MSRKIILIKQELLLLVYELNRSGLLAENEKIRPILAQLEKLLLC DLSPSTNDSVKN" variation 57 /note="am6 [14]" /replace="c" variation 117 /note="am6 [14]" /replace="a" CDS 133..393 /note="DNA maturation" /codon_start=1 /transl_table=11 /product="C" /protein_id="AAA32574.1" /db_xref="GI:216024" /translation="MRKFDLSLRSSRSSYFATFRHQLTILSKTDALDEEKWLNMLGTF VKDWFRYESHFVHGRDSLVDILKERGLLSESDAVQPLIGKKS" mRNA 358..3975 /product="major transcript" mRNA 358..991 /product="minor transcript" CDS 390..848 /function="capsid morphogenesis" /codon_start=1 /transl_table=11 /product="D" /protein_id="AAA32575.1" /db_xref="GI:216025" /translation="MSQVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWI ATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAE FTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVRQKLRAEGVM" CDS 568..843 /function="cell lysis" /codon_start=1 /transl_table=11 /product="E" /protein_id="AAA32576.1" /db_xref="GI:216026" /translation="MVRWTLWDTLAFLLLLSLLLPSLLIMFIPSTFKRPVSSWKALNL RKTLLMASSVRLKPLNCSRLPCVYAQETLTFLLTQKKTCVKNYVRKE" CDS 848..964 /note="core protein; DNA condensation" /codon_start=1 /transl_table=11 /product="J" /protein_id="AAA32577.1" /db_xref="GI:216027" /translation="MSKGKKRSGARPGRPQPLRGTKGKRKGARLWYVGGQQF" CDS 1001..2284 /note="major coat protein" /codon_start=1 /transl_table=11 /product="F" /protein_id="AAA32578.1" /db_xref="GI:216028" /translation="MSNIQTGAERMPHDLSHLGFLAGQIGRLITISTTPVIAGDSFEM DAVGALRLSPLRRGLAIDSTVDIFTFYVPHRHVYGEQWIKFMKDGVNATPLPTVNTTG YIDHAAFLGTINPDTNKIPKHLFQGYLNIYNNYFKAPWMPDRTEANPNELNQDDARYG FRCCHLKNIWTAPLPPETELSRQMTTSTTSIDIMGLQAAYANLHTDQERDYFMQRYHD VISSFGGKTSYDADNRPLLVMRSNLWASGYDVDGTDQTSLGQFSGRVQQTYKHSVPRF FVPEHGTMFTLALVRFPPTATKEIQYLNAKGALTYTDIAGDPVLYGNLPPREISMKDV FRSGDSSKKFKIAEGQWYRYAPSYVSPAYHLLEGFPFIQEPPSGDLQERVLIRHHDYD QCFQSVQLLQWNSQVKFNVTVYRNLPTTRDSIMTS" CDS 2395..2922 /note="major spike protein" /codon_start=1 /transl_table=11 /product="G" /protein_id="AAA32579.1" /db_xref="GI:216029" /translation="MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYF DSLTVNAGNGGFLHCIQMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTT LPTAYDVYPLNGRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVS LNQVIKEIICLQPLK" CDS 2931..3917 /function="adsorption" /note="minor spike protein" /codon_start=1 /transl_table=11 /product="H" /protein_id="AAA32580.1" /db_xref="GI:216030" /translation="MFGAIAGGIASALAGGAMSKLFGGGQKAASGGIQGDVLATDNNT VGMGDAGIKSAIQGSNVPNPDEAAPSFVSGAMAKAGKGLLEGTLQAGTSAVSDKLLDL VGLGGKSAADKGKDTRDYLAAAFPELNAWERAGADASSAGMVDAGFENQKELTKMQLD NQKEIAEMQNETQKEIAGIQSATSRQNTKDQVYAQNEMLAYQQKESTARVASIMENTN LSKQQQVSEIMRQMLTQAQTAGQYFTNDQIKEMTRKVSAEVDLVHQQTQNQRYGSSHI GATAKDISNVVTDAASGVVDIFHGIDKAVADTWNNFWKDGKADGIGSNLSRK" misc_feature 3962 /note="transcription start site" rep_origin 4306 /note="origin of viral strand synthesis" misc_feature 4899 /note="transcription start site" ORIGIN 1 gagttttatc gcttccatga cgcagaagtt aacactttcg gatatttctg atgagtcgaa 61 aaattatctt gataaagcag gaattactac tgcttgttta cgaattaaat cgaagtggac 121 tgctggcgga aaatgagaaa attcgaccta tccttgcgca gctcgagaag ctcttacttt 181 gcgacctttc gccatcaact aacgattctg tcaaaaactg acgcgttgga tgaggagaag 241 tggcttaata tgcttggcac gttcgtcaag gactggttta gatatgagtc acattttgtt 301 catggtagag attctcttgt tgacatttta aaagagcgtg gattactatc tgagtccgat 361 gctgttcaac cactaatagg taagaaatca tgagtcaagt tactgaacaa tccgtacgtt 421 tccagaccgc tttggcctct attaagctca ttcaggcttc tgccgttttg gatttaaccg 481 aagatgattt cgattttctg acgagtaaca aagtttggat tgctactgac cgctctcgtg 541 ctcgtcgctg cgttgaggct tgcgtttatg gtacgctgga ctttgtggga taccctcgct 601 ttcctgctcc tgttgagttt attgctgccg tcattgctta ttatgttcat cccgtcaaca 661 ttcaaacggc ctgtctcatc atggaaggcg ctgaatttac ggaaaacatt attaatggcg 721 tcgagcgtcc ggttaaagcc gctgaattgt tcgcgtttac cttgcgtgta cgcgcaggaa 781 acactgacgt tcttactgac gcagaagaaa acgtgcgtca aaaattacgt gcggaaggag 841 tgatgtaatg tctaaaggta aaaaacgttc tggcgctcgc cctggtcgtc cgcagccgtt 901 gcgaggtact aaaggcaagc gtaaaggcgc tcgtctttgg tatgtaggtg gtcaacaatt 961 ttaattgcag gggcttcggc cccttacttg aggataaatt atgtctaata ttcaaactgg 1021 cgccgagcgt atgccgcatg acctttccca tcttggcttc cttgctggtc agattggtcg 1081 tcttattacc atttcaacta ctccggttat cgctggcgac tccttcgaga tggacgccgt 1141 tggcgctctc cgtctttctc cattgcgtcg tggccttgct attgactcta ctgtagacat 1201 ttttactttt tatgtccctc atcgtcacgt ttatggtgaa cagtggatta agttcatgaa 1261 ggatggtgtt aatgccactc ctctcccgac tgttaacact actggttata ttgaccatgc 1321 cgcttttctt ggcacgatta accctgatac caataaaatc cctaagcatt tgtttcaggg 1381 ttatttgaat atctataaca actattttaa agcgccgtgg atgcctgacc gtaccgaggc 1441 taaccctaat gagcttaatc aagatgatgc tcgttatggt ttccgttgct gccatctcaa 1501 aaacatttgg actgctccgc ttcctcctga gactgagctt tctcgccaaa tgacgacttc 1561 taccacatct attgacatta tgggtctgca agctgcttat gctaatttgc atactgacca 1621 agaacgtgat tacttcatgc agcgttacca tgatgttatt tcttcatttg gaggtaaaac 1681 ctcttatgac gctgacaacc gtcctttact tgtcatgcgc tctaatctct gggcatctgg 1741 ctatgatgtt gatggaactg accaaacgtc gttaggccag ttttctggtc gtgttcaaca 1801 gacctataaa cattctgtgc cgcgtttctt tgttcctgag catggcacta tgtttactct 1861 tgcgcttgtt cgttttccgc ctactgcgac taaagagatt cagtacctta acgctaaagg 1921 tgctttgact tataccgata ttgctggcga ccctgttttg tatggcaact tgccgccgcg 1981 tgaaatttct atgaaggatg ttttccgttc tggtgattcg tctaagaagt ttaagattgc 2041 tgagggtcag tggtatcgtt atgcgccttc gtatgtttct cctgcttatc accttcttga 2101 aggcttccca ttcattcagg aaccgccttc tggtgatttg caagaacgcg tacttattcg 2161 ccaccatgat tatgaccagt gtttccagtc cgttcagttg ttgcagtgga atagtcaggt 2221 taaatttaat gtgaccgttt atcgcaatct gccgaccact cgcgattcaa tcatgacttc 2281 gtgataaaag attgagtgtg aggttataac gccgaagcgg taaaaatttt aatttttgcc 2341 gctgaggggt tgaccaagcg aagcgcggta ggttttctgc ttaggagttt aatcatgttt 2401 cagactttta tttctcgcca taattcaaac tttttttctg ataagctggt tctcacttct 2461 gttactccag cttcttcggc acctgtttta cagacaccta aagctacatc gtcaacgtta 2521 tattttgata gtttgacggt taatgctggt aatggtggtt ttcttcattg cattcagatg 2581 gatacatctg tcaacgccgc taatcaggtt gtttctgttg gtgctgatat tgcttttgat 2641 gccgacccta aattttttgc ctgtttggtt cgctttgagt cttcttcggt tccgactacc 2701 ctcccgactg cctatgatgt ttatcctttg aatggtcgcc atgatggtgg ttattatacc 2761 gtcaaggact gtgtgactat tgacgtcctt ccccgtacgc cgggcaataa cgtttatgtt 2821 ggtttcatgg tttggtctaa ctttaccgct actaaatgcc gcggattggt ttcgctgaat 2881 caggttatta aagagattat ttgtctccag ccacttaagt gaggtgattt atgtttggtg 2941 ctattgctgg cggtattgct tctgctcttg ctggtggcgc catgtctaaa ttgtttggag 3001 gcggtcaaaa agccgcctcc ggtggcattc aaggtgatgt gcttgctacc gataacaata 3061 ctgtaggcat gggtgatgct ggtattaaat ctgccattca aggctctaat gttcctaacc 3121 ctgatgaggc cgcccctagt tttgtttctg gtgctatggc taaagctggt aaaggacttc 3181 ttgaaggtac gttgcaggct ggcacttctg ccgtttctga taagttgctt gatttggttg 3241 gacttggtgg caagtctgcc gctgataaag gaaaggatac tcgtgattat cttgctgctg 3301 catttcctga gcttaatgct tgggagcgtg ctggtgctga tgcttcctct gctggtatgg 3361 ttgacgccgg atttgagaat caaaaagagc ttactaaaat gcaactggac aatcagaaag 3421 agattgccga gatgcaaaat gagactcaaa aagagattgc tggcattcag tcggcgactt 3481 cacgccagaa tacgaaagac caggtatatg cacaaaatga gatgcttgct tatcaacaga 3541 aggagtctac tgctcgcgtt gcgtctatta tggaaaacac caatctttcc aagcaacagc 3601 aggtttccga gattatgcgc caaatgctta ctcaagctca aacggctggt cagtatttta 3661 ccaatgacca aatcaaagaa atgactcgca aggttagtgc tgaggttgac ttagttcatc 3721 agcaaacgca gaatcagcgg tatggctctt ctcatattgg cgctactgca aaggatattt 3781 ctaatgtcgt cactgatgct gcttctggtg tggttgatat ttttcatggt attgataaag 3841 ctgttgccga tacttggaac aatttctgga aagacggtaa agctgatggt attggctcta 3901 atttgtctag gaaataaccg tcaggattga caccctccca attgtatgtt ttcatgcctc 3961 caaatcttgg aggctttttt atggttcgtt cttattaccc ttctgaatgt cacgctgatt 4021 attttgactt tgagcgtatc gaggctctta aacctgctat tgaggcttgt ggcatttcta 4081 ctctttctca atccccaatg cttggcttcc ataagcagat ggataaccgc atcaagctct 4141 tggaagagat tctgtctttt cgtatgcagg gcgttgagtt cgataatggt gatatgtatg 4201 ttgacggcca taaggctgct tctgacgttc gtgatgagtt tgtatctgtt actgagaagt 4261 taatggatga attggcacaa tgctacaatg tgctccccca acttgatatt aataacacta 4321 tagaccaccg ccccgaaggg gacgaaaaat ggtttttaga gaacgagaag acggttacgc 4381 agttttgccg caagctggct gctgaacgcc ctcttaagga tattcgcgat gagtataatt 4441 accccaaaaa gaaaggtatt aaggatgagt gttcaagatt gctggaggcc tccactatga 4501 aatcgcgtag aggctttgct attcagcgtt tgatgaatgc aatgcgacag gctcatgctg 4561 atggttggtt tatcgttttt gacactctca cgttggctga cgaccgatta gaggcgtttt 4621 atgataatcc caatgctttg cgtgactatt ttcgtgatat tggtcgtatg gttcttgctg 4681 ccgagggtcg caaggctaat gattcacacg ccgactgcta tcagtatttt tgtgtgcctg 4741 agtatggtac agctaatggc cgtcttcatt tccatgcggt gcactttatg cggacacttc 4801 ctacaggtag cgttgaccct aattttggtc gtcgggtacg caatcgccgc cagttaaata 4861 gcttgcaaaa tacgtggcct tatggttaca gtatgcccat cgcagttcgc tacacgcagg 4921 acgctttttc acgttctggt tggttgtggc ctgttgatgc taaaggtgag ccgcttaaag 4981 ctaccagtta tatggctgtt ggtttctatg tggctaaata cgttaacaaa aagtcagata 5041 tggaccttgc tgctaaaggt ctaggagcta aagaatggaa caactcacta aaaaccaagc 5101 tgtcgctact tcccaagaag ctgttcagaa tcagaatgag ccgcaacttc gggatgaaaa 5161 tgctcacaat gacaaatctg tccacggagt gcttaatcca acttaccaag ctgggttacg 5221 acgcgacgcc gttcaaccag atattgaagc agaacgcaaa aagagagatg agattgaggc 5281 tgggaaaagt tactgtagcc gacgttttgg cggcgcaacc tgtgacgaca aatctgctca 5341 aatttatgcg cgcttcgata aaaatgattg gcgtatccaa cctgca //